PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5AL_69590B897.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 80aa    MW: 9400.88 Da    PI: 11.6329
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5AL_69590B897.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.22.3e-105451353
                           HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1 13 NReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53
                           NR +A+rsR RK+++i eLe+ v  L+ e +aL  ++  l 
  Traes_5AL_69590B897.1  5 NRQSAQRSRVRKLQYISELERSVTGLQMEVSALSPRVAFLD 45
                           ****************************9999987776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147031.25E-16248No hitNo description
SuperFamilySSF579592.56E-10351No hitNo description
SMARTSM003380.0037357IPR004827Basic-leucine zipper domain
PfamPF001702.4E-8448IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-12551No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MILANRQSAQ RSRVRKLQYI SELERSVTGL QMEVSALSPR VAFLDHQRSL LTVQQPSQAK  60
NCRPCTRQDL QRWYRTFLPI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572005.11e-27PREDICTED: basic leucine zipper 19
SwissprotQ6K3R92e-26BZP19_ORYSJ; Basic leucine zipper 19
TrEMBLW5EXX41e-52W5EXX4_WHEAT; Uncharacterized protein
STRINGBRADI3G09340.13e-27(Brachypodium distachyon)
STRINGGRMZM2G158313_P014e-27(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.23e-25bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]